Skip to main content

Table 2 Amino acid sequences of mimotopes, peptides, and their derivatives for immunization

From: Induction of aquaporin 4-reactive antibodies in Lewis rats immunized with aquaporin 4 mimotopes

Mimotope IDMimotope:
Amino acid sequences including GGGS linker
Mimotope-KLH:
Mimotope-keyhole limpet hemocyanin fusions for immunization protocol 1
Mimotope-AQP4268–285:
Mimotopes fused with AQP4-reactive T cell epitope used for immunization protocol 2
I-04WRYHVHPTPFKSGGGSWRYHVHPTPFKSGGGSC- keyhole limpet hemocyaninWRYHVHPTPFKSKAAQQTKGSYMEVEDNRS
I-13GPFHFLHHHWSQGGGSGPFHFLHHHWSQGGGSC- keyhole limpet hemocyaninGPFHFLHHHWSQKAAQQTKGSYMEVEDNRS
I-18WSSHAHRHNHFRGGGS 
IV-04WPWHAHGNTRGIGGGSWPWHAHGNTRGIGGGSC- keyhole limpet hemocyaninWPWHAHGNTRGIKAAQQTKGSYMEVEDNRS
IV-27IQYAPGGSYSVIGGGS 
IV-38VKGHWHHLNHANGGGSVKGHWHHLNHANKAAQQTKGSYMEVEDNRS
II-01FPFWHRTHAWDRGGGS 
III-01WSWKHHHPIMPRGGGSWSWKHHHPIMPRGGGSC-keyhole limpet hemocyaninWSWKHHHPIMPRKAAQQTKGSYMEVEDNRS
  “mix”:
I-04 (WRYHVHPTPFKSGGGSC- keyhole limpet hemocyanin) +
I-13 (GPFHFLHHHWSQGGGSC- keyhole limpet hemocyanin) +
IV-04 (WPWHAHGNTRGIGGGSC- keyhole limpet hemocyanin) +
III-01 (WSWKHHHPIMPRGGGSC-keyhole limpet hemocyanin)
Neg.controls: 
II-17HFWGHHRTTSKVGGGS
random peptide L5SPRAISSYPLNEGGGS
random peptide L8FPTDSLRGDVGMGGGS
  1. There are no matching linear sequences of the mimotopes to human AQP4 loops A (TINWGGTEKPLPVD), C (TPPSVVGGLGVTMVHGNLT) or E (NWENHW)
  2. Loop sequences were taken from [29]